Notice:
- You need install pretrained protein language modoel ProtT5-XL-UniRef50 to generate enzyme representation, the link is provided on ProtT5-XL-U50.
- You need install pretrained molecular language modoel SMILES Transformer to generate substrate representation, the link is provided on SMILES Transformer.
- You also need install modoel PreKcat_model to predict, the link is provided on PreKcat_model.
other packages:
- Python v3.6.9 (Anaconda installation recommended)
- PyTorch v1.10.1+cu113
- pandas v1.1.5
- NumPy v1.19.5
- Example for how to predict enzyme turnover number from enzyme sequences and substrate structures by language model, PreKcat:
import torch
from build_vocab import WordVocab
from pretrain_trfm import TrfmSeq2seq
from utils import split
from transformers import T5EncoderModel, T5Tokenizer
import re
import gc
import numpy as np
import pandas as pd
import pickle
import math
def smiles_to_vec(Smiles):
pad_index = 0
unk_index = 1
eos_index = 2
sos_index = 3
mask_index = 4
vocab = WordVocab.load_vocab('vocab.pkl')
def get_inputs(sm):
seq_len = 220
sm = sm.split()
if len(sm)>218:
print('SMILES is too long ({:d})'.format(len(sm)))
sm = sm[:109]+sm[-109:]
ids = [vocab.stoi.get(token, unk_index) for token in sm]
ids = [sos_index] + ids + [eos_index]
seg = [1]*len(ids)
padding = [pad_index]*(seq_len - len(ids))
ids.extend(padding), seg.extend(padding)
return ids, seg
def get_array(smiles):
x_id, x_seg = [], []
for sm in smiles:
a,b = get_inputs(sm)
x_id.append(a)
x_seg.append(b)
return torch.tensor(x_id), torch.tensor(x_seg)
trfm = TrfmSeq2seq(len(vocab), 256, len(vocab), 4)
trfm.load_state_dict(torch.load('trfm_12_23000.pkl'))
trfm.eval()
x_split = [split(sm) for sm in Smiles]
xid, xseg = get_array(x_split)
X = trfm.encode(torch.t(xid))
return X
def Seq_to_vec(Sequence):
sequences_Example = []
for i in range(len(Sequence)):
zj = ''
for j in range(len(Sequence[i]) - 1):
zj += Sequence[i][j] + ' '
zj += Sequence[i][-1]
sequences_Example.append(zj)
tokenizer = T5Tokenizer.from_pretrained("prot_t5_xl_uniref50", do_lower_case=False)
model = T5EncoderModel.from_pretrained("prot_t5_xl_uniref50")
gc.collect()
print(torch.cuda.is_available())
# 'cuda:0' if torch.cuda.is_available() else
device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu')
model = model.to(device)
model = model.eval()
features = []
for i in range(len(sequences_Example)):
print('For sequence ', str(i+1))
sequences_Example_i = sequences_Example[i]
sequences_Example_i = [re.sub(r"[UZOB]", "X", sequences_Example_i)]
ids = tokenizer.batch_encode_plus(sequences_Example_i, add_special_tokens=True, padding=True)
input_ids = torch.tensor(ids['input_ids']).to(device)
attention_mask = torch.tensor(ids['attention_mask']).to(device)
with torch.no_grad():
embedding = model(input_ids=input_ids, attention_mask=attention_mask)
embedding = embedding.last_hidden_state.cpu().numpy()
for seq_num in range(len(embedding)):
seq_len = (attention_mask[seq_num] == 1).sum()
seq_emd = embedding[seq_num][:seq_len - 1]
features.append(seq_emd)
features_normalize = np.zeros([len(features), len(features[0][0])], dtype=float)
for i in range(len(features)):
for k in range(len(features[0][0])):
for j in range(len(features[i])):
features_normalize[i][k] += features[i][j][k]
features_normalize[i][k] /= len(features[i])
return features_normalize
if __name__ == '__main__':
sequences = ['MEDIPDTSRPPLKYVKGIPLIKYFAEALESLQDFQAQPDDLLISTYPKSGTTWVSEILDMIYQDGDVEKCRRAPVFIRVPFLEFKA'
'PGIPTGLEVLKDTPAPRLIKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYRMAKVHPDPDTWDSFLEKFMAGEVSYGSW'
'YQHVQEWWELSHTHPVLYLFYEDMKENPKREIQKILKFVGRSLPEETVDLIVQHTSFKEMKNNSMANYTTLSPDIMDHSISAFMRK'
'GISGDWKTTFTVAQNERFDADYAKKMEGCGLSFRTQL']
Smiles = ['OC1=CC=C(C[C@@H](C(O)=O)N)C=C1']
seq_vec = Seq_to_vec(sequences)
smiles_vec = smiles_to_vec(Smiles)
fused_vector = np.concatenate((smiles_vec, seq_vec), axis=1)
with open('PreKcat_new/PreKcat_model.pkl', "rb") as f:
model = pickle.load(f)
Pre_label = model.predict(fused_vector)
Pre_label_pow = [math.pow(10, Pre_label[i]) for i in range(len(Pre_label))]
print(len(Pre_label))
res = pd.DataFrame({'sequences': sequences, 'Smiles': Smiles, 'Pre_label': Pre_label})
res.to_excel('PreKcat_predicted_label.xlsx')